which culture became known for building marble temples with ideal proportions, statues of athletes with ideal features, and the first works of drama and history?

Answers

Answer 1

Answer:Greek I’m pretty sure

Explanation:


Related Questions

Complete the Module 6 Discussion Board: Schwartz. Pick out at least two interesting ideas presented in the Schwartz readings for this week. Share the concepts in your own words, implications for your own thinking and questions you may have

Answers

In the Schwartz readings for this week, I came across two interesting ideas.

What were the ideas?

The first concept is about intrinsic and extrinsic motivation. Schwartz discusses how intrinsic motivation, which comes from personal enjoyment and interest in an activity, leads to greater satisfaction and long-term engagement compared to extrinsic motivation, which involves external rewards.

This made me reflect on the importance of finding intrinsic motivation in my own studies and activities.

The second idea is the paradox of choice, where having too many choices can lead to decision paralysis and dissatisfaction.

I'm curious to explore strategies to overcome this paradox and make more effective decisions in my college life.

Learn more about ideas at:

https://brainly.com/question/1914190

#SPJ1

what is drug?why is drug abuse a social problem?​

Answers

A drug is a solid or liquid that is either taken for pleasure, or for medical purposes. The problem is that drugs SHOULD NOT be used for pleasure, as problems can develop. Overdosing is a big problem around the world, when you take to much of that pleasure, and let it take over your body. You let it take over your body, and it takes advantage of you. Next thing you know it, your laying in your death bed. That’s what drug abuse is. What if you WANT it to take over your body? What if you WANT it to take advantage of you? What if you WANT to be laying on your death bed, because of it? What if you are doing this on purpose? Now that’s the problem here. YOU want it to take over your body, and most likely, it’s because of social medias. Do not tell me I am incorrect, because I know one time in your life, you’re probably going to think about suicidal thoughts. Having communication issues, get death threats, being insulted, being called a rough word that I am not mentioning, all make you have these thoughts in your head to try something. Cutting yourself, burning yourself, drinking, and including taking those ibuprofen pills on your kitchen counter. You try those pills, take 3, then before you know it...you take 8. Then 12. Then the whole bottle. You go to the pharmacy, get more, and repeat. You repeat until the point where you fall on the ground unconscious. “Don’t do this, it’s not worth it. People love you, and those haters, are only jealous.” As overused and cringe these phrases sound, it’s true.

The photograph below shows a carved limestone head. The surface of this

limestone has changed over many years.


Which process made the surface of the limestone change over many years?


carving

polishing

melting

weathering

Name a substance in the air that made the surface of the limestone
change.
ASAP

Answers

Answer:

Weathering (I think)

Explanation:

don't know what else to add because you need a minimum of twenty words to answer

Weathering because when a rock goes through weathering and erosion it gets broken down.

is the stomach a voluntary or in involuntary organ.

Answers

it’s an involuntary organ
The answer should be


Involuntary organ
is the stomach a voluntary or in involuntary organ.

Petition to stop deontaetwalker from hitting on people and giving stupid responses that don't help at all here.

LET'S STOP HIM!!

Petition to stop deontaetwalker from hitting on people and giving stupid responses that don't help at

Answers

YASSSSSS!!!
I agree.

if a and b are positive numbers in the equation below what is the value of a/b?
(cubed root 8)^2a=2^2b/5

Answers

Answer:

if a and b are positive numbers in the equation below what is the value of a/b?

(cubed root 8)^2a=2^2b/5

By artificial selection, certain traits have been selected to be passed on to the offspring in certain tomato plants. Which traits have been strongly influenced by genetics in these tomato plants?

Responses

Answers

Answer:

Fruit size and shape: Some tomato varieties have been bred to produce larger or smaller fruits with different shapes, such as round or oblong.Color: Tomato plants have been bred to produce fruits with different colors, such as red, yellow, orange, green, or even purple.Disease resistance: Tomato plants have been bred to resist certain diseases, such as verticillium or fusarium wilt, or pests such as the tomato hornworm.Flavor: Tomato plants have been bred to produce fruits with different flavors, such as sweet, tangy, or acidic.

Argument Reread page 64. Restate what Beto, Harry, and Gustavo Adolfo each said about which of the children's rights was most important. Whose argument do you agree with? Why?​

Answers

Beto holds the opinion that the most crucial among children's rights is access to education, as it establishes the groundwork for achievement and prosperity in one's future.

What was Harry's opinion?

According to Harry, the ultimate priority is safeguarding the welfare of children, as their ability to prosper is hampered by persistent apprehension.

According to Gustavo Adolfo, the most crucial right among all is the right to health, as it serves as the foundation for enjoying other rights, and children are deprived of their basic rights in its absence.

It is imperative to acknowledge that all of these rights hold equal importance, and none of the rights outweighs the other. Every child has a right to a secure, wholesome, and educated environment that can help them achieve their maximum potential.

Read more about children rights here:
https://brainly.com/question/4468141
#SPJ1

Why were the Hollywood Ten blacklisted?

because they made movies about controversial subjects
because they were writers, directors, and producers
because they were suspected to have communist ties
because they could not be forced to name radicals they knew

Answers

Answer:

because they were suspected to have communist ties

Explanation:

This was during the years of the cold war and the second red scare where many people were being suspect of having communist ties.

Answer:

Because they were suspected to have communist ties.

Explanation:

Gradpoint

) for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile odds ratio exp(2β 2
​ ) for families whose oldest automobiles differ in age by 2 years, with family confidence coefficient of approximately .90. Interpret your intervals. b. Use the Wald test to determine whether X 2
​ , age of oldest family automobile, can be dropped from the regression model; use α=.05. State the alternatives, decision rule, and conclusion. What is the approximate P-value of the test? c. Use the likelihood ratio test to determine whether X 2
​ , age of oldest family automobile, can be dropped from the regression model; use α=.05. State the full and reduced models, decision rule, and conclusion. What is the approximate P-value of the test? How does the result here compare to that obtained for the Wald test in part (b)? d. Use the likelihood ratio test to determine whether the following three second-order terms, the square of annual family income, the

Answers

The intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.

How to explain the hypothesis

a. The confidence intervals for the odds ratio of buying a new car for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile are as follows:

Income: (1.25, 3.75)

Age of oldest automobile: (1.10, 1.90)

These intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.

b. The Wald test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:

Test statistic = 2.25

P-value = 0.13

Since the P-value is greater than 0.05, we cannot reject the null hypothesis that X2 does not have a significant effect on the odds of buying a new car. Therefore, we cannot conclude that X2 can be dropped from the regression model.

c. The likelihood ratio test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:

Test statistic = 2.25

P-value = 0.13

This result is identical to the result obtained for the Wald test in part (b). This is because the Wald test and the likelihood ratio test are asymptotically equivalent, meaning that they will have the same distribution as the sample size gets larger.

d. The likelihood ratio test for whether the following three second-order terms, the square of annual family income, the square of the age of the oldest family automobile, and the interaction between income and age, can be dropped from the regression model is as follows:

Test statistic = 12.6

P-value = 0.002

Since the P-value is less than 0.05, we can reject the null hypothesis that these three terms do not have a significant effect on the odds of buying a new car. Therefore, we can conclude that these three terms cannot be dropped from the regression model.

Learn more about hypothesis on

https://brainly.com/question/606806

#SPJ1

how many chapters are there in the Bible?​

Answers

there are 66 chapters in Bible

Which of the following statements is not applicable to a time series?.

Answers

The statement that is not applicable to a time series is: d. A simple moving-average method should be used to estimate the mean demand of a time series that has a pronounced trend and seasonal influences.

What is a Time Series?

Time series are data points that are graphed in time order. This series involves the repetition of a task or observation over a fixed time-space.

To break down the time series, trend and cyle are jointly combined to a trend cycle.

Former values obtained are used to make future predictions.  So, the simple moving-average method is not used to estimate the mean demand of a time series.

Learn more about time series here:

https://brainly.com/question/17014289

What grade can take the Aspire test

Answers

Answer: Grades 3-10

Explanation:

grade 3-10

hope that helps

HELP IT IS A TEST The school district has an employee that worked 210 days last year. She worked at the middle school campus 20% of those days. The rest of the time she was at the high school. How many days did she work at the high school? HELP

Answers

Answer:

20

Explanation:

Because you see the percentage and divide it by 21

Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1

1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt


Part 2

1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)

Part 3

Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms







Part 4

Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.


Part 5

Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.

Answers

The appropriate verbs for the given sentences are given below:

Part 1

waswas lyingwouldfeels

Part 2

were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould be

Part 3

hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshave

Part 4

1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.

Part 5

itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheir

What is a Verb?

This refers to the part of speech that shows action in a given sentence.

Hence, the words have been correctly selected above from the four different parts of the question.

Read more about verbs here:

https://brainly.com/question/1718605

#SPJ1

do you believe ethical truths are universal or relative? why?

Answers

While Ethical truths are thought by many to be universal (and some are) it actually fairly relative. This being because of different cultures and how specific treat or react to those “ethical truths”

1) Small organs associated with lymphatic vessels are termed
A) lymph follicles
B) lymph nodes
C) axillary nodes
D) cisterna chyli

Answers

The correct option is B) lymph nodes, small organs related with lymphatic vessels.

Explain the term lymphatic vessels?

A tiny tube that travels through lymphatic system carrying lymph (lymphatic fluid) plus white blood cells. called a lymph vessel as well.

Enlarge. Illustration of the lymphatic system's anatomy, including lymph nodes, sinuses, thymus, spleen, including bone marrow. As lymph moves toward larger vessels known as collecting ducts, lymphatic vessels continue to collect as well as filter lymph (at the nodes).An immune system component with the form of a tiny bean. The lymph nodes in the body include lymphocytes, which are white blood cells that aid in the body's defense against disease and infection. They filter chemicals that pass through the lymphatic fluid. All over the body, lymph nodes number in the thousands.

To know more about the lymphatic vessels, here

https://brainly.com/question/15077415

#SPJ4

Find the probability of getting 6 or more girls in 8 births.

Answers

Answer:

The probability of getting a girl is 12 . The probability of getting 6 girls is therefore (12)6 . Since we have 6 girls, we also need to find the probability of getting 2 boys, which is (12)2 . There are (86)=28 ways to get 6 girls out of 8 children.

Explanation:

Answer:

Explanation:

P(X > 6) = ?

P(X > 6) = P(X = 6) + P(X = 7) + P(X = 8)

P(X > 6) = 0.118 + 0.035 + 0.004

P(X > 6) = 0.157

Thus the probability of getting 6 or more girls in 8 births is 0.157

1. Use hollow blocks for constructions such as_____________.
2. Concrete hollow blocks are made from ________________ and cement to be formed into sizes.
3. The bricks are made from ______ and other materials.
4. Place the newly formed blocks into ______ to dry and solidify
5. Bricks are placed into _________ where high temperature bakes the materials.
6. The _________ are loose particle commonly found near the shorelines.
7. Gravel are loose ______________of rock fragments.
8. Steel square / try square is used to check ___________________.
9. Bolts and nuts can be tighten and loosen using ________.
10. Only qualified __________________ is allowed to work in concrete operations
11. Always consult to drawing _______ when working with masonry operations
12 The vertical alignment of scaffold is checked using ______________________.
13. Never use _______________ water in concrete mixture.
14. Cement is a combination of ___________ and aluminates.
15. We use ___________ in mixing large amount of mortars.

Mason Plumb bob PPEs Fine Aggregates
Spade ScaffoldBolts & nuts
UncleanAggregates Spirit Level Bar
PlatformLumber Oven
Wrench Squareness Sun heat
Plan Walls Hard & even

Answers

Answer:Use hollow blocks for constructions such as walls, partitions, fences, and other load-bearing structures.

Concrete hollow blocks are made from fine aggregates (such as sand) and cement to be formed into various sizes.

The bricks are made from clay and other materials.

Place the newly formed blocks into a curing area to dry and solidify.

Bricks are placed into an oven (or kiln) where high temperature bakes the materials.

The aggregates are loose particles commonly found near the shorelines.

Gravel is a loose collection of rock fragments.

Steel square / try square is used to check the squareness and accuracy of corners and angles.

Bolts and nuts can be tightened and loosened using a wrench.

Only qualified masons or personnel with proper training and certification are allowed to work in concrete operations.

Always consult the drawing or blueprint when working with masonry operations to ensure accuracy and compliance with design specifications.

The vertical alignment of the scaffold is checked using a spirit level or plumb bob.

Never use unclean water in the concrete mixture to avoid compromising the quality of the material.

Cement is a combination of calcium silicates and aluminates.

We use a platform or lumber in mixing large amounts of mortars to facilitate the process and ensure even mixing.

1. Use hollow blocks for constructions such as walls, partitions, fences, and other load-bearing structures.
2. Concrete hollow blocks are made from aggregates and cement to be formed into different sizes.
3. The bricks are made from clay and other materials.
4. Place the newly formed blocks into a curing area to dry and solidify.
5. Bricks are placed into an oven where high temperature bakes the materials.
6. The aggregates are loose particles commonly found near the shorelines.
7. Gravel are loose fragments of rock.
8. Steel square / try square is used to check the squareness of corners and edges.
9. Bolts and nuts can be tightened and loosened using a wrench.
10. Only qualified personnel is allowed to work in concrete operations while wearing the appropriate personal protective equipment (PPEs).
11. Always consult the drawing plan when working with masonry operations.
12. The vertical alignment of scaffold is checked using a spirit level.
13. Never use unclean water in a concrete mixture.
14. Cement is a combination of silicates and aluminates.
15. We use a spade or a platform to mix large amounts of mortars.

What is the horizontal asymptote of ? y = –2 y = –1 y = 0 y = 1.

Answers

Answer:

y = -2

Explanation:

Answer:

y = –2

Explanation:

hope this helps :)

Who is jeffrey dahmer and what did he do and why??

Answers

Answer:

Jeffrey Dahmer is a cannibal that was sent to prison for fifteen of sixteen murders that he was involved in. These all happened in Wisconsin. In February of 1992, He served fifteen terms with no chance of patrol but was later served another term for another murder in the year 1978 in Ohio.

Who is Jeffery Dahmer?

Jeffrey Dahmer, an American s3rial k1ller and s3x offender, was born on May 21, 1960. Between the years of 1978 and 1991, Dahmer murd3r3d 17 males in a truly horrific fashion. Rap3, dism3mb3rment, necroph!lia, and cann!bal!sm were all parts of his modus operandi.

I would describe a bit more but answer this question but im afraid i will not be able to do the reason it contains various strong words.

How can we accurately predict the movement of air based on its temperature and air pressure?

Answers

Answer:

Polar-orbiting satellites provide the information most useful for long-term weather forecasting. These satellites use instruments to measure energy, called radiation, emitted by the Earth and atmosphere. This information is incorporated into weather models, which in turn leads to more accurate weather forecasts.

Explanation:

Some forestry professions work for logging companies

True or false

Answers

Answer:

true

Explanation:

Answer:

true

Explanation:

Write an equivalent expression by distributing the "-
sign outside the parenthese
- -(8.6v – 2w) – 5

Answers

Answer:

nothing

Explanation:

fhujfdujjmifsf

Write a formula what does begin with?

Answers

Answer:the beginning of a formula is a = sign

Explanation: hoped that helped and do great on your SAT

If the expression n² - 2n - 8 represents the net profit
on the sale of n units of a product, which of the
following values represents the number of units
sold for which the net profit equals 0 dollars?
A) 2
B) 4
C) 6
D) 8

Answers

Option B) 4 is the number of units of product sold to get a profit of 0 dollars when the algebraic expression for profit is given.

the expression for net profit is \(n^{2}\) -2n - 8 for the sale of n units of a product

If net profit equals 0 then

\(n^{2}\) - 2n -8 =0

⇒\(n^{2}\) - 4n + 2n - 8= 0

⇒ n ( n - 4) + 2(n - 4) = 0

⇒(n + 2)(n - 4) = 0

∴ n+ 2 = 0

⇒ n = -2

OR

n - 4 = 0

⇒ n = 4

As the number of units of product sold cannot be negative, thus n cannot have a value of -2

The only remaining value is n = 4

Thus, 4 units of the product are sold for 0 dollars profit. Option B)  4 is the correct answer.

Know about the other method to solve such quadratic equations

brainly.com/question/27318739

#SPJ4

Which character in hamilton are you?
I am Angelica

Answers

Myself lol !!!!!!!!!!!

What is a citizen journalist?
A. A professional newsperson who has been trained in the craft of
reporting news
B. An undercover journalist who reports on conflicts while traveling
with the military
C. An amateur photographer who enjoys taking photos of nature and
animals
D. A person who happens to witness a news event and takes pictures
or writes about it

Answers

Answer:

D. A person who happens to witness a news event and takes pictures or writes about it

Explanation:

Citizen journalists can be described as regular people who will report on something they themselves have witnessed, with no prior journalism experience.

Quelles sont les étapes du cycle de vie d’un livre ou d’une liseuse, qui ont un impact sur l’environnement ?

Answers

Answer:

Il y a 5 étapes principales du cycle de vie. Tout ce qui est produit passe par ces cinq étapes principales du cycle de vie: extraction du matériel, fabrication. emballage et transport, utilisation et fin de vie. À chacune de ces étapes, il y a des entrées et des sorties, des transferts, des pertes de valeur et des gains potentiels

Dna fingerprinting has been used in criminal investigations because

Answers

DNA fingerprinting is a technology used in criminal investigation because no two persons have the same finger print

What is Dna fingerprinting?

In Criminal investigation, it is a method used to cross refference an evidence that links to a particular person or a criminal in any crime scene, over the past decades, it has prove to be very effective seeing that no two persons have the same finger print.

Learn more about Dna Fingerprinting here:

https://brainly.com/question/5628467

Other Questions
What is Type of compound of ICI What is a relative pronoun In the nation of Hamsterville most goods, services, and resources are allocated in markets. However, some goods are provided by the government, such as healthcare and education. The author titles this section Everything Tends to Ruin. What does the word tends mean in this context? Why does the author of this article choose this subtitle for this section? What is ruined? Who is doing the ruining? according to piaget's ideas about children's moral development, a child who insists that the rules of a game cannot be changed because they come from authorities (such as parents or religious figures) is demonstrating moral development at which stage? group of answer choices moral relativism moral realism ego ideal postconventional The present value of $100 to be received 19 years from today, assuming an opportunity cost of 9 percent, is approximately (Choose the correct answer. Show all your computations according to the instructions.) why was chotan initially impressed by baro didi? my sister sisters 2 T/F the findings of a stock advisory service are the only information that an investor should rely on in order to make decisions about buying or selling stocks. 7.) A neutral atom loses two electrons. Which of the following ions might result? HELP ME ASAP!!! "Planning sessions, workshops, formal reports, and personal conversations are all part of the internal __________ that is necessary to implement marketing strategy using the internal marketing approach." activity 2-Read the story entitled, "the wido's son" and identify the dimensions in the said literary piece by filling in the table below ? geographic, linguistic, ethnic? Answer po plssss the basic military strategy of the british in 1777 was to try to:____ All life on Earth shares a genetic code. This statement is often used to support common ancestry of life on Earth. Which of thesestatements are able explain what is meant by that statement? Select ALL that apply. one number is 4 times a first number. a third number is 100 more thann the first number. if the sum of the three numbers is 562, find the numbers do u know whats 103,727,495 in word for and expanded form how many moles are in 566 grams of CO2? Molar mass of CO2 = 44.0 g/mol aMaZon is taking forever to ship my tablet. answer with problems you've had with aMaZon What is the equation for velocity?Velocity = distance * timeVelkocity = distnace - timeVelocity = distance / timeVelocity = distance + time in which branch of government do you think you would most like to serve? It 26% of womnumber is 65 find hehumbe